RetrogeneDB ID: | retro_ocun_674 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 13:135744931..135745164(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL13A | ||
| Ensembl ID: | ENSOCUG00000025258 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L13a [Source:HGNC Symbol;Acc:10304] |
| Percent Identity: | 51.9 % |
| Parental protein coverage: | 66.1 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | KRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQ-AVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKN |
| K.M..P..L..VRLKP.R..A.LGR.A...GWK.Q..VTATL.E.R.EKA..H..K.....RLR..A..N | |
| Retrocopy | KWMAAPVVLEAVRLKPMRQPASLGRRACAAGWK*Q<GVTATLGEERMEKAEVHFQKERRPPRLRQEAGRN |
| Parental | VEKKISKFT |
| .EK.IS..T | |
| Retrocopy | GEKEISAVT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .06 RPM | 131 .02 RPM |
| SRP017611_kidney | 0 .00 RPM | 349 .17 RPM |
| SRP017611_liver | 0 .00 RPM | 66 .52 RPM |