RetrogeneDB ID: | retro_nleu_1029 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397279.1:6519828..6520221(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NME2 | ||
| Ensembl ID: | ENSNLEG00000007919 | ||
| Aliases: | None | ||
| Description: | Nucleoside diphosphate kinase [Source:UniProtKB/TrEMBL;Acc:G1R8Y6] |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 74.01 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 4 |
| Parental | TMANCER-TFIAIK-PDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDL-LKEHYVDLKDRPFFAGLVK |
| TMAN....TFIAIK.PD.VQRGL.G.I.K.FEQK.F.LV..KF...SE...LK.HY...KD.PFF..LVK | |
| Retrocopy | TMANRSA<TFIAIK>PDSVQRGLAGKIMKCFEQKRFHLVAMKFLWVSENI<LKQHYIHWKDCPFFPRLVK |
| Parental | -YMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEI |
| ....SGPV..MVWEGLN.VKTG.VM.GETNP.DSKP.TI.GDF.IQVG..IIHG..SV.SAEKEI | |
| Retrocopy | >NRNSGPVLPMVWEGLNAVKTG*VMVGETNPVDSKPHTICGDFSIQVG*CIIHGNGSVVSAEKEI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000004651 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000023628 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016526 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000028492 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015559 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000091228 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000007919 | 2 retrocopies |
retro_nleu_1029 , retro_nleu_1030,
|
| Nomascus leucogenys | ENSNLEG00000008068 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000022135 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000009415 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000002693 | 3 retrocopies |