RetrogeneDB ID: | retro_mmus_814 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 11:65037051..65037498(-) | ||
| Located in intron of: | ENSMUSG00000033389 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000083935 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Taf9 | ||
| Ensembl ID: | ENSMUSG00000078941 | ||
| Aliases: | Ak6, 2810046E22Rik, 4921516M08Rik, AK/ATPase | ||
| Description: | TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:MGI Symbol;Acc:MGI:1888697] |
| Percent Identity: | 58.55 % |
| Parental protein coverage: | 84.88 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | RSGLKYVNVGDLA-REGQ-LYDGYDEEYGCPILDEDRVVDELEHQMQEGGVIVDYHGCDFFPERWFHIVF |
| ..GLKY.NV.DLA..EG..LYDGYDE.Y.C.ILD.DR.VDELE.QM..G..IVDY.G...FPE...HIVF | |
| Retrocopy | KTGLKYKNVADLA>QEGRFLYDGYDE*YDCLILDNDRAVDELESQMRQGRIIVDYCGYESFPEH*IHIVF |
| Parental | VLRTDNGVLYKR---LETRGYNEKKLQDNIQCEIF-QVLYEEAIASYKEEIVHQLPSNEPEQLEDNINQI |
| V.R..NG.L......L...G..............F.QVLYEEAIASYKEEIVH.LP.NE.E.L.DN.N.I | |
| Retrocopy | VFRS-NGILXXXXXDLKQGGLMRREYKTGFSVRVF<QVLYEEAIASYKEEIVHPLPNNELEELNDNVNLI |
| Parental | SKWIEQWVKDHN |
| .KWI.QWVKD.N | |
| Retrocopy | TKWIGQWVKDNN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .07 RPM | 5 .96 RPM |
| SRP007412_cerebellum | 0 .22 RPM | 6 .21 RPM |
| SRP007412_heart | 0 .09 RPM | 6 .57 RPM |
| SRP007412_kidney | 0 .02 RPM | 10 .49 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .20 RPM |
| SRP007412_testis | 0 .00 RPM | 13 .49 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012471 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000036421 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000024524 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015545 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016022 | 12 retrocopies | |
| Myotis lucifugus | ENSMLUG00000028932 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000019421 | 14 retrocopies | |
| Mustela putorius furo | ENSMPUG00000014588 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000078941 | 2 retrocopies |
retro_mmus_3717, retro_mmus_814 ,
|
| Nomascus leucogenys | ENSNLEG00000004086 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000020970 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027736 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000015527 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000016949 | 10 retrocopies | |
| Rattus norvegicus | ENSRNOG00000039848 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017216 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024448 | 2 retrocopies |