RetrogeneDB ID: | retro_meug_1547 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold448489:66..390(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMEUG00000016022 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.48 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MRLPNILLTGTPGVGKTTLGKELASRTGLTYVNVGDLAQEGQLYDGFDEEYECPILDEDRVVDELENKMK |
| .RLP.ILL.GTPG.GKTTLGKELASRTGLTYV.VG.L.Q.GQ.YDG.DEEYECPILDEDR.V.EL.NKMK | |
| Retrocopy | IRLPRILLSGTPGIGKTTLGKELASRTGLTYVDVGKLTQVGQIYDGVDEEYECPILDEDRAVYELKNKMK |
| Parental | EGGVIVDYHGCDFFPERWFHIVFVLQTDNSVLYPRLEK |
| .G.VIVDYHG.DFFPE.WFH..FVLQTDNSVLY.RLEK | |
| Retrocopy | DGRVIVDYHGYDFFPELWFHSIFVLQTDNSVLYMRLEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012471 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000036421 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000024524 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015545 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016022 | 12 retrocopies | |
| Myotis lucifugus | ENSMLUG00000028932 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000019421 | 14 retrocopies | |
| Mustela putorius furo | ENSMPUG00000014588 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000078941 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004086 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000020970 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027736 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000015527 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000016949 | 10 retrocopies | |
| Rattus norvegicus | ENSRNOG00000039848 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017216 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024448 | 2 retrocopies |