RetrogeneDB ID: | retro_mmus_403 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:191407660..191407956(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Pabpn1 | ||
| Ensembl ID: | ENSMUSG00000022194 | ||
| Aliases: | None | ||
| Description: | poly(A) binding protein, nuclear 1 [Source:MGI Symbol;Acc:MGI:1859158] |
| Percent Identity: | 84.0 % |
| Parental protein coverage: | 59.76 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | SEELEAIK-ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARSIYVGNVDYGAT |
| SEELE.IK.A.V.E.EEEAEKLKELQ..VEKQ.NMSPPPGNAGPVIMSLEEKMEADA.SIYVGNV.YGAT | |
| Retrocopy | SEELESIKQA*VWETEEEAEKLKELQSKVEKQANMSPPPGNAGPVIMSLEEKMEADACSIYVGNVNYGAT |
| Parental | AEELEAH-FHGCGSVNRVTILCDKFSGHPK |
| AEEL.AH...GCGSVN.VTILCDKFSGHP. | |
| Retrocopy | AEELGAH<LNGCGSVNCVTILCDKFSGHPR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 36 .89 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 36 .39 RPM |
| SRP007412_heart | 0 .03 RPM | 9 .87 RPM |
| SRP007412_kidney | 0 .00 RPM | 20 .33 RPM |
| SRP007412_liver | 0 .00 RPM | 12 .07 RPM |
| SRP007412_testis | 0 .18 RPM | 31 .70 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000006884 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000007960 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000002873 | 1 retrocopy | |
| Homo sapiens | ENSG00000100836 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000022683 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000031227 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000014747 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000006775 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000022194 | 1 retrocopy |
retro_mmus_403 ,
|
| Nomascus leucogenys | ENSNLEG00000015009 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016174 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000008710 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005663 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000006168 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000002023 | 1 retrocopy |