RetrogeneDB ID: | retro_mmus_3519 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:122452367..122452775(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000086452 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Fam133b | ||
| Ensembl ID: | ENSMUSG00000058503 | ||
| Aliases: | None | ||
| Description: | family with sequence similarity 133, member B [Source:MGI Symbol;Acc:MGI:1915402] |
| Percent Identity: | 50.74 % |
| Parental protein coverage: | 55.51 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWK |
| .GK.D..VAYM.PIAMAR.RG..QS.G.TIQ.YLNRPRPT.EEVK.QL..KKKGSKAL.EFEEKMN..W. | |
| Retrocopy | LGKQDTCVAYMTPIAMARWRGASQSEGTTIQGYLNRPRPTLEEVKKQLQNKKKGSKALTEFEEKMNQIWT |
| Parental | KELEKHREKLLSGNESSSKKRQKKKKEKKKSGRYSSSSSSSSDSSSSSSDSEDEDKKQTKRRKKKK |
| KEL....EK.LSGN.SS.............S..Y...........S.S.......K...K...K.. | |
| Retrocopy | KELKNNKEKALSGNVSSYXXXXXXXXXXXXSCQYTXXXXXXXXXXSFSDLEDETKKQEKKMKEKEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 16 .40 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 27 .31 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .35 RPM |
| SRP007412_kidney | 0 .00 RPM | 17 .11 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .88 RPM |
| SRP007412_testis | 0 .00 RPM | 28 .63 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000007438 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013910 | 3 retrocopies | |
| Equus caballus | ENSECAG00000026810 | 1 retrocopy | |
| Homo sapiens | ENSG00000234545 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000029755 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000005933 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019802 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000058503 | 2 retrocopies |
retro_mmus_3481, retro_mmus_3519 ,
|
| Nomascus leucogenys | ENSNLEG00000015333 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025825 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000009163 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000015317 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000028195 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011674 | 1 retrocopy |