RetrogeneDB ID: | retro_cjac_4095 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | X:83183453..83183780(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSCJAG00000008256 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FAM133B | ||
| Ensembl ID: | ENSCJAG00000013910 | ||
| Aliases: | None | ||
| Description: | family with sequence similarity 133, member B [Source:HGNC Symbol;Acc:28629] |
| Percent Identity: | 83.49 % |
| Parental protein coverage: | 98.2 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAEFEEKMNENWK |
| MGKRDNRVAYMNPIAMAR.RGP.QS.GPTIQDYLNRPRPTWEEVK.QLE.KK.GSKALAEFEEKMNENWK | |
| Retrocopy | MGKRDNRVAYMNPIAMARWRGPTQSVGPTIQDYLNRPRPTWEEVKKQLENKKRGSKALAEFEEKMNENWK |
| Parental | KELEKHREKLLSGSESSSKKRQRKKKEKKKSGRVSKSFS |
| KELEK.R.KLLSG.ESSSKK..RK.K.KKKS.R.S...S | |
| Retrocopy | KELEKSRQKLLSGNESSSKKKERKRKRKKKSCRSSSPSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 7 .06 RPM |
| SRP051959_heart | 0 .00 RPM | 7 .23 RPM |
| SRP051959_kidney | 0 .00 RPM | 9 .54 RPM |
| SRP051959_liver | 0 .00 RPM | 5 .98 RPM |
| SRP051959_lung | 0 .00 RPM | 9 .39 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 12 .19 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 5 .28 RPM |
| SRP051959_spleen | 0 .00 RPM | 12 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000007438 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013910 | 3 retrocopies |
retro_cjac_1084, retro_cjac_1163, retro_cjac_4095 ,
|
| Equus caballus | ENSECAG00000026810 | 1 retrocopy | |
| Homo sapiens | ENSG00000234545 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000029755 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000005933 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019802 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000058503 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000015333 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025825 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000009163 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000015317 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000028195 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011674 | 1 retrocopy |