RetrogeneDB ID: | retro_mmus_3512 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:119413302..119413714(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000081587 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ube2c | ||
| Ensembl ID: | ENSMUSG00000001403 | ||
| Aliases: | Ube2c, 1110015A16Rik, D2Ertd695e | ||
| Description: | ubiquitin-conjugating enzyme E2C [Source:MGI Symbol;Acc:MGI:1915862] |
| Percent Identity: | 78.99 % |
| Parental protein coverage: | 76.54 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | GPVGKRLQQELMILMTSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKF |
| GP..KRLQQELM.LM..GDKGIS.FPESDNL..WVGTIHGAA..VYED.RYK.SLEFPSGYPY..PTVKF | |
| Retrocopy | GPMDKRLQQELMTLMMYGDKGISTFPESDNLYQWVGTIHGAANSVYEDRRYKNSLEFPSGYPYTIPTVKF |
| Parental | LTPCYHPNVDTQGNICLDIL-KDKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKY |
| LT.CYH.NVDTQ.NI.LDIL.KDKWSALYDVRTIL..IQSLL.EPNI.SPLNT...ELWKN..AF.KY | |
| Retrocopy | LTSCYHSNVDTQVNIYLDIL>KDKWSALYDVRTILHYIQSLLEEPNINSPLNTNTGELWKNSIAFNKY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .23 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .30 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .72 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .89 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .25 RPM |
| SRP007412_testis | 0 .00 RPM | 5 .85 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000014102 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000011774 | 4 retrocopies | |
| Homo sapiens | ENSG00000175063 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000026061 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000007177 | 14 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006715 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000021023 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000013661 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000001403 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000025939 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004989 | 3 retrocopies | |
| Ochotona princeps | ENSOPRG00000014284 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000011071 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000013564 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000000369 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000015131 | 5 retrocopies | |
| Tursiops truncatus | ENSTTRG00000015987 | 1 retrocopy |