RetrogeneDB ID: | retro_mmus_3361 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 9:80043876..80044122(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl26 | ||
| Ensembl ID: | ENSMUSG00000060938 | ||
| Aliases: | Rpl26, SIG-20 | ||
| Description: | ribosomal protein L26 [Source:MGI Symbol;Acc:MGI:106022] |
| Percent Identity: | 78.05 % |
| Parental protein coverage: | 56.55 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 0 |
| Parental | PLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPS |
| PL......K.NV.SM.I.KDDEVQVVRGHYKGQQIGKV.QV.RK.YVIYI..VQ.EKANGTTVHV.IHPS | |
| Retrocopy | PLFPKS*DK*NVWSMHI*KDDEVQVVRGHYKGQQIGKVAQVFRKNYVIYIKQVQ*EKANGTTVHVDIHPS |
| Parental | KVVITRLKLDKD |
| KVVITRLKL.KD | |
| Retrocopy | KVVITRLKLGKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 82 .07 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 43 .77 RPM |
| SRP007412_heart | 0 .00 RPM | 61 .58 RPM |
| SRP007412_kidney | 0 .00 RPM | 56 .40 RPM |
| SRP007412_liver | 0 .00 RPM | 60 .43 RPM |
| SRP007412_testis | 0 .00 RPM | 61 .02 RPM |