RetrogeneDB ID: | retro_mmus_2441 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:25541793..25542039(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000081789 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ptges3 | ||
| Ensembl ID: | ENSMUSG00000071072 | ||
| Aliases: | Ptges3, 5730442A20Rik, Ptges, Tebp, cPGES, p23, sid3177 | ||
| Description: | prostaglandin E synthase 3 (cytosolic) [Source:MGI Symbol;Acc:MGI:1929282] |
| Percent Identity: | 95.18 % |
| Parental protein coverage: | 51.88 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | RKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMDHMGGDEDVDLPEVDGADDD |
| RKG.SGQSW.RLTKERAKLNWLSV.FNNWKDWEDDSDEDMSNFD.FSEMMDHMGGDEDVDLPEVDGADDD | |
| Retrocopy | RKG-SGQSWRRLTKERAKLNWLSVNFNNWKDWEDDSDEDMSNFDHFSEMMDHMGGDEDVDLPEVDGADDD |
| Parental | SQDSDDEKMPDLE |
| SQDSDDEKMPDLE | |
| Retrocopy | SQDSDDEKMPDLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 35 .91 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 29 .92 RPM |
| SRP007412_heart | 0 .03 RPM | 21 .36 RPM |
| SRP007412_kidney | 0 .02 RPM | 37 .94 RPM |
| SRP007412_liver | 0 .00 RPM | 40 .25 RPM |
| SRP007412_testis | 0 .05 RPM | 59 .87 RPM |