RetrogeneDB ID: | retro_mmur_1054 | ||
Retrocopy location | Organism: | Mouse Lemur (Microcebus murinus) | |
| Coordinates: | scaffold_17980:9371..9623(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMICG00000017513 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 84.52 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | QVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRGYGNSSDSRYDDGRGPPGNPPRRMGRI |
| QVL.SRSQSPWRLSLIT.F.WGIAEFVVLFFKTLL.QDVKK.RGYGNSSDSRYDDGRGP.GNPP..MG.I | |
| Retrocopy | QVLNSRSQSPWRLSLITYFLWGIAEFVVLFFKTLL*QDVKKGRGYGNSSDSRYDDGRGPLGNPP*GMG*I |
| Parental | NHLRGPSPPPMAGG |
| NHL..PSPP..AGG | |
| Retrocopy | NHLLRPSPPLIAGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007612 | 8 retrocopies | |
| Cavia porcellus | ENSCPOG00000007172 | 4 retrocopies | |
| Homo sapiens | ENSG00000113811 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000681 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000017513 | 2 retrocopies |
retro_mmur_1054 , retro_mmur_202,
|
| Myotis lucifugus | ENSMLUG00000012622 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000019272 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000042682 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026533 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000002266 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000025894 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000015030 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000016291 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014624 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000011459 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000506 | 2 retrocopies |