RetrogeneDB ID: | retro_cjac_2086 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 22:9672810..9673029(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000007612 | ||
| Aliases: | None | ||
| Description: | selenoprotein K [Source:RefSeq peptide;Acc:NP_001186844] |
| Percent Identity: | 68.0 % |
| Parental protein coverage: | 79.12 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | LSLITDFFWGIAEFVVLFFKTLLQQ-DV-KKRRSYGNSSDSRYDDGRGPPGNPPRRMGRI-NHLRGPSPP |
| .SLITD.FWGIAEFV.LFFKTLLQQ.DV..K...Y.NSSDS.Y.DGR.P.GNPPRR.G.....L..PSPP | |
| Retrocopy | VSLITDIFWGIAEFVILFFKTLLQQ>DVEEKKKGYRNSSDSSYVDGRQPAGNPPRRTGQV<HLLHYPSPP |
| Parental | PMAGG |
| PM..G | |
| Retrocopy | PMPSG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .18 RPM | 9 .74 RPM |
| SRP051959_heart | 0 .14 RPM | 12 .40 RPM |
| SRP051959_kidney | 0 .16 RPM | 14 .04 RPM |
| SRP051959_liver | 0 .30 RPM | 13 .49 RPM |
| SRP051959_lung | 0 .62 RPM | 9 .65 RPM |
| SRP051959_lymph_node | 0 .39 RPM | 9 .31 RPM |
| SRP051959_skeletal_muscle | 0 .04 RPM | 21 .20 RPM |
| SRP051959_spleen | 0 .67 RPM | 12 .37 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007612 | 8 retrocopies |
retro_cjac_1748, retro_cjac_2086 , retro_cjac_2144, retro_cjac_2374, retro_cjac_2684, retro_cjac_2825, retro_cjac_3897, retro_cjac_726,
|
| Cavia porcellus | ENSCPOG00000007172 | 4 retrocopies | |
| Homo sapiens | ENSG00000113811 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000681 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000017513 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012622 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000019272 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000042682 | 9 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026533 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000002266 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000025894 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000015030 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000016291 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014624 | 4 retrocopies | |
| Sus scrofa | ENSSSCG00000011459 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000000506 | 2 retrocopies |