RetrogeneDB ID: | retro_mmul_1908 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 5:134756763..134756994(+) | ||
| Located in intron of: | ENSMMUG00000003697 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.12924 | ||
| Ensembl ID: | ENSMMUG00000023126 | ||
| Aliases: | None | ||
| Description: | U6 snRNA-associated Sm-like protein LSm3 [Source:RefSeq peptide;Acc:NP_001248293] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 75.49 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | DERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLV |
| DERIY.KM.ND..L.GRLHA.DQHLNM.LGDVEETV.TIE.DE..YE.I.KSTK..IP.LF..GD..VLV | |
| Retrocopy | DERIYMKMGND*RLQGRLHA*DQHLNMMLGDVEETVATIETDEQIYEGICKSTKLSIPTLFIQGDDAVLV |
| Parental | APPLRVG |
| .PPL.VG | |
| Retrocopy | VPPLKVG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 10 .31 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .93 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 9 .88 RPM |
| SRP007412_heart | 0 .00 RPM | 13 .13 RPM |
| SRP007412_kidney | 0 .00 RPM | 30 .05 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .25 RPM |
| SRP007412_testis | 0 .00 RPM | 56 .99 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2986 |
| Pan troglodytes | retro_ptro_2020 |
| Gorilla gorilla | retro_ggor_2068 |
| Pongo abelii | retro_pabe_2475 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000007363 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016977 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000006671 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018032 | 7 retrocopies | |
| Echinops telfairi | ENSETEG00000016207 | 8 retrocopies | |
| Homo sapiens | ENSG00000170860 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000023308 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000023126 | 5 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000011088 | 1 retrocopy | |
| Oreochromis niloticus | ENSONIG00000000370 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013402 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000014650 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008733 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000011601 | 6 retrocopies | |
| Tursiops truncatus | ENSTTRG00000011197 | 1 retrocopy |