RetrogeneDB ID: | retro_mmul_1255 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 16:30777466..30777715(-) | ||
| Located in intron of: | ENSMMUG00000005550 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2792 | ||
| Ensembl ID: | ENSMMUG00000007136 | ||
| Aliases: | None | ||
| Description: | translocase of outer mitochondrial membrane 20 homolog [Source:RefSeq peptide;Acc:NP_001247980] |
| Percent Identity: | 77.65 % |
| Parental protein coverage: | 57.24 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | VGRNSAIAAGVCGALFIGYCIYFDRKRRSD-PNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFF |
| .GRN.A.AA.VCGALFIGYCIYFDR.RRSD.PN.KNRL.E.RKKQKLA.ER..LSK..DLKDAEA.QKF. | |
| Retrocopy | LGRNGAVAAEVCGALFIGYCIYFDRRRRSD<PNLKNRLPEERKKQKLAEERVELSKFADLKDAEAAQKFC |
| Parental | LEEIQL-GEELLAQG |
| LEE.QL.GEE.LAQG | |
| Retrocopy | LEETQL>GEEILAQG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 28 .80 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 52 .60 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 26 .86 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .07 RPM |
| SRP007412_kidney | 0 .00 RPM | 21 .60 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .48 RPM |
| SRP007412_testis | 0 .00 RPM | 14 .55 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1827 |
| Pan troglodytes | retro_ptro_1166 |