RetrogeneDB ID: | retro_mmul_1011 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 13:112365987..112366414(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POLR2D | ||
| Ensembl ID: | ENSMMUG00000001989 | ||
| Aliases: | None | ||
| Description: | DNA-directed RNA polymerase II subunit RPB4 [Source:RefSeq peptide;Acc:NP_001254716] |
| Percent Identity: | 79.02 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | MAAGGGDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFM-KTLNYTA |
| MAAGG.DP.AG.VEED..QL.FP.EFETA.TLLNSE.H.LLEHRKQ.NESAEDEQELSEVF..K..NYT. | |
| Retrocopy | MAAGGSDPQAGNVEEDT*QLMFPEEFETAKTLLNSEIHVLLEHRKQ*NESAEDEQELSEVFV>KQRNYTG |
| Parental | RFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRS |
| .FS.F.NRETIAS..SLLLQKKLHKF.L.CLANLCPETAEESKA.IPSLE..FEDEEL.QILD..QTK.S | |
| Retrocopy | CFSGFENRETIASICSLLLQKKLHKFKLVCLANLCPETAEESKAPIPSLERWFEDEEL*QILDGSQTKGS |
| Parental | FQY |
| FQY | |
| Retrocopy | FQY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 5 .38 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .24 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .62 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .24 RPM |
| SRP007412_kidney | 0 .00 RPM | 4 .93 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .54 RPM |
| SRP007412_testis | 0 .00 RPM | 12 .59 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_1571 |
| Gorilla gorilla | retro_ggor_1658 |
| Pongo abelii | retro_pabe_1933 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011746 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000004311 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000013850 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008527 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027816 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004723 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001989 | 1 retrocopy |
retro_mmul_1011 ,
|
| Monodelphis domestica | ENSMODG00000018653 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000016685 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024258 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000021449 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000005327 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000012759 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000012436 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000009037 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000014817 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000023329 | 3 retrocopies |