RetrogeneDB ID: | retro_dnov_734 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_10301:8430..8827(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | POLR2D | ||
| Ensembl ID: | ENSDNOG00000008527 | ||
| Aliases: | None | ||
| Description: | polymerase (RNA) II (DNA directed) polypeptide D [Source:HGNC Symbol;Acc:9191] |
| Percent Identity: | 60.15 % |
| Parental protein coverage: | 92.86 % |
| Number of stop codons detected: | 5 |
| Number of frameshifts detected: | 1 |
| Parental | GDVEEDASQLIFPKEFEAAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETI |
| G..EE.AS.LI.P..FE.AE.LLNSE.HMLLEH.KQQ.E..ED.QELSEVF.K.L.YTA.F...KNRETI | |
| Retrocopy | GSLEEEASHLILPTGFEVAEILLNSELHMLLEH*KQQCENTED*QELSEVFRKSLTYTAHFI*IKNRETI |
| Parental | ASVRSLLIQKKHQKLEMAAVAKLCPEMEEESEAVVPSLEG-RFEEEDLQHSLDAI--KCSFQY |
| .SV.SLL......K.E.A..A.L..E..EE..A..PSL.G..FE.E.LQ..LD.I..KCSFQY | |
| Retrocopy | TSVLSLLFRENLPKFELAYLANL*LETAEEFKALMPSLGG>QFEDEELQQILDDI*TKCSFQY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 2 .14 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 3 .71 RPM |
| SRP012922_heart | 0 .00 RPM | 0 .70 RPM |
| SRP012922_kidney | 0 .00 RPM | 1 .37 RPM |
| SRP012922_liver | 0 .00 RPM | 1 .86 RPM |
| SRP012922_lung | 0 .00 RPM | 3 .05 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 1 .21 RPM |
| SRP012922_spleen | 0 .11 RPM | 4 .01 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000011746 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000004311 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000013850 | 3 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000008527 | 1 retrocopy |
retro_dnov_734 ,
|
| Felis catus | ENSFCAG00000027816 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004723 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000001989 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000018653 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000016685 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024258 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000021449 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000005327 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000012759 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000012436 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000009037 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000014817 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000023329 | 3 retrocopies |