RetrogeneDB ID: | retro_mluc_2147 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL430061:741127..741441(+) | ||
| Located in intron of: | ENSMLUG00000001663 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMLUG00000000585 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.72 % |
| Parental protein coverage: | 96.43 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MAAYEQVQKGPLKLKGVAELGVTKRKKKK-KDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQ |
| .AAYEQVQKGP.KL.G.AELGVTKR.KKK.KDKD..KLL...GTSKKN.E....G.....P......K.. | |
| Retrocopy | LAAYEQVQKGP*KLRGIAELGVTKR-KKK<KDKDIVKLLVIRGTSKKNREVAWPG--QADPGPGSLRKRR |
| Parental | EKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKV |
| ........LKK.SKTHKQRVE.F.RH...L.EH.DIPKV | |
| Retrocopy | RGGSKWK*LKKTSKTHKQRVEEFTRHPEALREHCDIPKV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046846 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014097 | 4 retrocopies | |
| Homo sapiens | ENSG00000105058 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022418 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000009394 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013721 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000585 | 2 retrocopies |
retro_mluc_2147 , retro_mluc_59,
|
| Monodelphis domestica | ENSMODG00000014904 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016048 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000003039 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005441 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002238 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027763 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010641 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000039528 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013855 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009106 | 1 retrocopy |