RetrogeneDB ID: | retro_ptro_1480 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 22:16074285..16074530(+) | ||
| Located in intron of: | ENSPTRG00000014036 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FAM32A | ||
| Ensembl ID: | ENSPTRG00000010641 | ||
| Aliases: | None | ||
| Description: | family with sequence similarity 32, member A [Source:HGNC Symbol;Acc:24563] |
| Percent Identity: | 83.13 % |
| Parental protein coverage: | 73.21 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQE |
| ..AYEQVQKG.LKLKGVAEL.VTKRKKKKKDKDKAKL.E.MG..KKNE.EK..GLDK.TPA.AAFEKMQE | |
| Retrocopy | VDAYEQVQKGLLKLKGVAELRVTKRKKKKKDKDKAKLPESMGMNKKNEGEKQHGLDKWTPARAAFEKMQE |
| Parental | KRQ-MERILKKAS |
| KRQ.MERILKKAS | |
| Retrocopy | KRQ<MERILKKAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 49 .30 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 41 .48 RPM |
| SRP007412_heart | 0 .00 RPM | 22 .33 RPM |
| SRP007412_kidney | 0 .00 RPM | 73 .12 RPM |
| SRP007412_liver | 0 .00 RPM | 56 .99 RPM |
| SRP007412_testis | 0 .11 RPM | 18 .23 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2541 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046846 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014097 | 4 retrocopies | |
| Homo sapiens | ENSG00000105058 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000022418 | 4 retrocopies | |
| Loxodonta africana | ENSLAFG00000009394 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000013721 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000585 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000014904 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000016048 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000003039 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005441 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000027763 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000010641 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000039528 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013855 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000009106 | 1 retrocopy |