RetrogeneDB ID: | retro_mdom_1774 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 7:53810676..53810950(-) | ||
| Located in intron of: | ENSMODG00000000682 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AP4S1 | ||
| Ensembl ID: | ENSMODG00000017579 | ||
| Aliases: | None | ||
| Description: | adaptor-related protein complex 4, sigma 1 subunit [Source:HGNC Symbol;Acc:575] |
| Percent Identity: | 57.45 % |
| Parental protein coverage: | 63.89 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | IKTCLTRSKEQCSFIEYKDFKLIYRQYAALFIVVGINDTENEMAVYEFIHNF-VEVLDMYFSRVSELDIM |
| ....L..SKEQCSFI.YK.FKLIY.QY...F..V.IN...NEM..YE.IHNF...V.D..FS.V.E.D.M | |
| Retrocopy | VREPLSNSKEQCSFIKYKHFKLIYWQYVTIFTMVRINKADNEMDIYESIHNF<FKVSDKGFSQVPE*DTM |
| Parental | FNLDKVHII-LDEMVLNGCIVETN |
| .NLD.VHII.LD..VL..C.V.TN | |
| Retrocopy | INLDQVHII<LDQTVLHNCMVKTN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 20 .03 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 29 .71 RPM |
| SRP007412_heart | 0 .00 RPM | 23 .52 RPM |
| SRP007412_kidney | 0 .00 RPM | 38 .19 RPM |
| SRP007412_liver | 0 .00 RPM | 36 .25 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000013301 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005786 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000009468 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000013009 | 1 retrocopy | |
| Homo sapiens | ENSG00000100478 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000003198 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011671 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003123 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000017197 | 7 retrocopies | |
| Monodelphis domestica | ENSMODG00000017579 | 1 retrocopy |
retro_mdom_1774 ,
|
| Monodelphis domestica | ENSMODG00000021198 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000015901 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000014031 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000005723 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000006239 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000017161 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005765 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000010759 | 1 retrocopy |