RetrogeneDB ID: | retro_lafr_146 | ||
Retrocopy location | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_0:96436461..96436710(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FAM136A | ||
| Ensembl ID: | ENSLAFG00000002304 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.36 % |
| Parental protein coverage: | 62.32 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MAELQQLRVQEAVDSMVKSLERENIRKMQGIMF-RCSASCCEDSQASMQQVHQCIERCH-APLAQAQALV |
| M.EL.QLRV..AVDSMVK.LE.E.IRKM.GI.F.R....C...SQASM....QC.ERCH..PLAQAQALV | |
| Retrocopy | MVELHQLRVHKAVDSMVKGLETETIRKMWGIVF>RATSCC-GHSQASMLRLYQCTERCH<SPLAQAQALV |
| Parental | TSELEKFQDRLARCTMHC |
| TS.LEK.Q......T..C | |
| Retrocopy | TSQLEKIQHQIQ--TVYC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000008674 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000003353 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000009117 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000019447 | 7 retrocopies | |
| Felis catus | ENSFCAG00000008119 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000023247 | 6 retrocopies | |
| Loxodonta africana | ENSLAFG00000002304 | 1 retrocopy |
retro_lafr_146 ,
|
| Macropus eugenii | ENSMEUG00000015791 | 8 retrocopies | |
| Macaca mulatta | ENSMMUG00000007962 | 5 retrocopies | |
| Monodelphis domestica | ENSMODG00000011533 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000057497 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000016273 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000017418 | 8 retrocopies |