RetrogeneDB ID: | retro_lafr_1252 | ||
Retrocopy location | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_98:2168160..2168584(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CCDC90A | ||
| Ensembl ID: | ENSLAFG00000003287 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 57.24 % |
| Parental protein coverage: | 67.62 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | QEITLQQVMSQIASVK-KDMIILEKSEFS-ALRAENEKIKLELLQLKQQVTDEMIKVRTDTKLDFNLEKS |
| Q..TL.Q..SQ.A.V..K....LEKSEF...LRAENEKIK....QLK.Q......K...DTKLD..LE.S | |
| Retrocopy | QTTTLGQTTSQSAGVG<KGVMVLEKSEFF>SLRAENEKIKIKPCQLKRQGMKDS-KYEADTKLDLDLERS |
| Parental | RVKELYSLNERKLLEMRTEVVALHAQ-QDRALTQTDRKIDTEVAGLKTMLESHKLDNIKYLAGSVFTCLT |
| .VKE.YSLNERKL.EMR....AL..Q.QD.A...TD...DTE.AG..T...SHK.DN.KYLA.SVF.CLT | |
| Retrocopy | *VKEQYSLNERKLSEMRAAAAALRDQ>QDWAHSHTDQVTDTEAAGPQTLPKSHKFDNVKYLARSVFKCLT |
| Parental | VALGF |
| .A.GF | |
| Retrocopy | EAVGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000395 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000009857 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000016050 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000014899 | 1 retrocopy | |
| Equus caballus | ENSECAG00000009150 | 2 retrocopies | |
| Felis catus | ENSFCAG00000005972 | 3 retrocopies | |
| Homo sapiens | ENSG00000050393 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002632 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003287 | 2 retrocopies |
retro_lafr_1252 , retro_lafr_870,
|
| Microcebus murinus | ENSMICG00000000183 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010975 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000000698 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000914 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013458 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000017740 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000012562 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000012874 | 1 retrocopy |