RetrogeneDB ID: | retro_ggor_743 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 11:105308333..105308674(-) | ||
| Located in intron of: | ENSGGOG00000005498 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MOB4 | ||
| Ensembl ID: | ENSGGOG00000009005 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.17 % |
| Parental protein coverage: | 60.43 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | EGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNI-DKI-LEPPEGQDEGVWKYE |
| .GT.V...............WPD.SFDEMDSTLAVQQY.QQNIR.....I..KI.LEPPEGQD.G.WKYE | |
| Retrocopy | DGTVVMAEGMAMLRWTRLGTWPDDSFDEMDSTLAVQQYTQQNIRVKIAPILTKI<LEPPEGQDAGIWKYE |
| Parental | HLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPK |
| HLRQFCLELNGLAVKLQ..CHPDTCTQMTATEQWIFLCAAHKTP. | |
| Retrocopy | HLRQFCLELNGLAVKLQTDCHPDTCTQMTATEQWIFLCAAHKTPR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 10 .02 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 4 .89 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .56 RPM |
| SRP007412_kidney | 0 .04 RPM | 3 .43 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .32 RPM |
| SRP007412_testis | 0 .00 RPM | 5 .80 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_640 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004020 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000012746 | 2 retrocopies | |
| Homo sapiens | ENSG00000115540 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009005 | 2 retrocopies |
retro_ggor_733, retro_ggor_743 ,
|
| Latimeria chalumnae | ENSLACG00000015430 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016547 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000012305 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000005712 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000272 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000016650 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000013047 | 6 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000017821 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021024 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000001726 | 1 retrocopy |