RetrogeneDB ID: | retro_ggor_706 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 11:40738826..40739278(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ZCCHC9 | ||
| Ensembl ID: | ENSGGOG00000013790 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.63 % |
| Parental protein coverage: | 55.72 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | QAAKKNAMVCFHCRKPGHGIADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKC-FVC |
| QAAK...MVCF.CRKPGH..ADCP.ALENQD.GTG.C...GS.E....K..AKV..AL..FPF.KC.FVC | |
| Retrocopy | QAAKRKTMVCFYCRKPGHTTADCPVALENQDTGTGTCSGSGSMERKMIKGRAKVALALN*FPFVKC<FVC |
| Parental | GEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSE-RMVTVGRWAKGMSADYEEILDVPKP |
| GEM..LSRSCPD.PKGL.ADGGGCKLC.SVE..KKDCPESQNS...MVTV..W.KG.SAD.EEI....K. | |
| Retrocopy | GEMRQLSRSCPDHPKGLCADGGGCKLCCSVEYFKKDCPESQNSDFGMVTVDCWPKGVSADSEEIG*L-KS |
| Parental | QKPKTKIPKVVNF |
| QK.KTKIPK.V.F | |
| Retrocopy | QKSKTKIPKIVIF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 11 .03 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 11 .98 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .91 RPM |
| SRP007412_kidney | 0 .00 RPM | 22 .98 RPM |
| SRP007412_liver | 0 .00 RPM | 19 .41 RPM |
| SRP007412_testis | 0 .00 RPM | 34 .91 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_602 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000005265 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000008703 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000005268 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000019486 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000003838 | 2 retrocopies | |
| Homo sapiens | ENSG00000131732 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013790 | 1 retrocopy |
retro_ggor_706 ,
|
| Myotis lucifugus | ENSMLUG00000001886 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020655 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021621 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000002543 | 6 retrocopies | |
| Pongo abelii | ENSPPYG00000015604 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000017047 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014927 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000008580 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000014504 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001407 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000013796 | 1 retrocopy |