RetrogeneDB ID: | retro_ggor_2870 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 9:87865836..87866190(-) | ||
| Located in intron of: | ENSGGOG00000007210 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRSF10 | ||
| Ensembl ID: | ENSGGOG00000000392 | ||
| Aliases: | None | ||
| Description: | serine/arginine-rich splicing factor 10 [Source:HGNC Symbol;Acc:16713] |
| Percent Identity: | 80.17 % |
| Parental protein coverage: | 59.02 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | YTRRPRGFAYVQYTFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDY |
| Y....RGFA.VQ..FE.VRDAED.L.NLDRKWICG.Q.EIQFAQGDRKTPNQMKAKEGRN.YSSSRYDDY | |
| Retrocopy | YSPSKRGFASVQ--FEGVRDAEDTLYNLDRKWICGGQTEIQFAQGDRKTPNQMKAKEGRNTYSSSRYDDY |
| Parental | DRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDR |
| .RYRR.RS.SYERRRSRS.SF..NYRRSY.PRN.R..GRPR.SRSHSDNDR | |
| Retrocopy | NRYRRPRS*SYERRRSRSQSFHNNYRRSYNPRN-RLAGRPRSSRSHSDNDR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 12 .08 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 14 .70 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .19 RPM |
| SRP007412_kidney | 0 .00 RPM | 14 .23 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .02 RPM |
| SRP007412_testis | 0 .00 RPM | 58 .02 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4295 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009869 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000008072 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004836 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000020883 | 9 retrocopies | |
| Cavia porcellus | ENSCPOG00000024533 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000008699 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000014286 | 1 retrocopy | |
| Homo sapiens | ENSG00000188529 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000000392 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000014378 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000028520 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015845 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013180 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000029326 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015374 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001726 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007992 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000000956 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000016150 | 2 retrocopies |