RetrogeneDB ID: | retro_ggor_2693 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 8:134598062..134598362(+) | ||
| Located in intron of: | ENSGGOG00000007362 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DPPA3 | ||
| Ensembl ID: | ENSGGOG00000013040 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 56.0 % |
| Parental protein coverage: | 61.64 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | RRESVGAAVLREIEDEWLYSRRGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNKEPKGVKKE--SRPF |
| ......A..L..I.D..LY.RRGV.TLLSVQ.E.MA.LRY.LL..V...ER..TN...KG...E..S.PF | |
| Retrocopy | QQQHTRAMILK*IRDDLLYKRRGVKTLLSVQKERMAKLRYPLLSTVPRLERELTNTQLKGLQNE*RSEPF |
| Parental | KCPCSFCVSNGWDPSENARIGNQDTKPLQP |
| .C.CSFC..N..DPSENARIG..DTK.LQP | |
| Retrocopy | QCCCSFCIFNR*DPSENARIGDYDTKSLQP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .52 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4010 |
| Pan troglodytes | retro_ptro_2722 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046609 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000032092 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005409 | 10 retrocopies | |
| Homo sapiens | ENSG00000187569 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013040 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000017530 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000046323 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026887 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000024813 | 7 retrocopies | |
| Pongo abelii | ENSPPYG00000004230 | 6 retrocopies | |
| Pan troglodytes | ENSPTRG00000004617 | 7 retrocopies | |
| Rattus norvegicus | ENSRNOG00000022950 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000000751 | 3 retrocopies |