RetrogeneDB ID: | retro_ggor_2529 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 7:91102628..91103087(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSGGOG00000026388 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFAF4 | ||
| Ensembl ID: | ENSGGOG00000012070 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 83.01 % |
| Parental protein coverage: | 87.43 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MGALVIRGIRNFNLENRAEREISKMKPSVAPRHPSTNSLLREQISLYPEVKGEIARKDEKLLSFLKDVYV |
| MGA.V.RGIRNFNLEN.AEREISKMKPS.....PSTNSLL.EQISLYPE.K.EIARKDEK.LSFLKDVYV | |
| Retrocopy | MGAAVTRGIRNFNLENPAEREISKMKPSPTLGYPSTNSLLQEQISLYPEIKVEIARKDEKMLSFLKDVYV |
| Parental | DSKDPVSSLQVKAAETCQEPKEFRLPKDHHFDMINIKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQ |
| DSKDPVSS.QVKAAET.QEP.EFRLPK.HHFD.INIKSIPKGKISI.EALT.LNNHKL..ETWTAEKI.Q | |
| Retrocopy | DSKDPVSSVQVKAAETRQEPEEFRLPKGHHFDIINIKSIPKGKISIIEALTFLNNHKLYQETWTAEKIAQ |
| Parental | EYQLEQKDVNSLL |
| .Y.LEQKDV.S.L | |
| Retrocopy | GYHLEQKDVSSPL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .02 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 5 .59 RPM |
| SRP007412_heart | 0 .00 RPM | 4 .97 RPM |
| SRP007412_kidney | 0 .08 RPM | 9 .73 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .25 RPM |
| SRP007412_testis | 0 .00 RPM | 7 .56 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3761 |
| Pan troglodytes | retro_ptro_2552 |
| Pongo abelii | retro_pabe_3160 |
| Macaca mulatta | retro_mmul_1717 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003174 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005145 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001235 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000007618 | 1 retrocopy | |
| Homo sapiens | ENSG00000123545 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012070 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000015734 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018843 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000028261 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013568 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002152 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016857 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000018435 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007506 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000010911 | 1 retrocopy |