RetrogeneDB ID: | retro_fcat_564 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B1:124227734..124227974(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PTS | ||
| Ensembl ID: | ENSFCAG00000024702 | ||
| Aliases: | None | ||
| Description: | 6-pyruvoyltetrahydropterin synthase [Source:HGNC Symbol;Acc:9689] |
| Percent Identity: | 85.0 % |
| Parental protein coverage: | 54.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VTGMVMNMTDLKEYMEEAIMKPLDHKNLDLDVPYFADVVSTTENVAVYIWENLQKFLPMGVLYKVKVYET |
| VTG.VMNMT.LK..MEEAIMKP.DHKNLDLDVPYFADV.STTENVAVYIWENLQKFLP.GVLYKVKVY.T | |
| Retrocopy | VTGVVMNMTYLKKNMEEAIMKPHDHKNLDLDVPYFADVTSTTENVAVYIWENLQKFLPLGVLYKVKVYKT |
| Parental | DNNVVVYKGE |
| D...VV.KGE | |
| Retrocopy | DITIVVCKGE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 4 .36 RPM |
| SRP017611_kidney | 0 .00 RPM | 8 .24 RPM |
| SRP017611_liver | 0 .00 RPM | 4 .14 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003968 | 3 retrocopies | |
| Bos taurus | ENSBTAG00000003770 | 3 retrocopies | |
| Canis familiaris | ENSCAFG00000013915 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000014823 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000008145 | 2 retrocopies | |
| Felis catus | ENSFCAG00000024702 | 3 retrocopies |
retro_fcat_1546, retro_fcat_212, retro_fcat_564 ,
|
| Myotis lucifugus | ENSMLUG00000023388 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015255 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000001975 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000015040 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010526 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000000061 | 1 retrocopy |