RetrogeneDB ID: | retro_fcat_207 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | A1:219907346..219907678(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSFCAG00000022230 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NFYB | ||
| Ensembl ID: | ENSFCAG00000026471 | ||
| Aliases: | None | ||
| Description: | nuclear transcription factor Y, beta [Source:HGNC Symbol;Acc:7805] |
| Percent Identity: | 69.03 % |
| Parental protein coverage: | 53.66 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KDAKECVQEC--VSEFISFITSEASERCHQEKRKTINGEDILF-AMSTLGFDSYVEPLKLYLQKFREAMK |
| KD.K.C...C....EFISFI..EASERCHQEK.K...G....F..MSTLGF.SYVEPLKLY.QKFREAMK | |
| Retrocopy | KDWKRCPRMCSRMCEFISFIRGEASERCHQEKWKAV-GKILSF<SMSTLGFNSYVEPLKLYIQKFREAMK |
| Parental | GEKGIGGAVTTTDGLSEELTEEAFTNQLPAGLITADGQQQNVM |
| G.K.IGG.VT...GLS.E..EEAFTNQLPAGLITADGQQ.N.. | |
| Retrocopy | GKKRIGGTVTAIEGLSDEHIEEAFTNQLPAGLITADGQQLNIL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 16 .64 RPM |
| SRP017611_kidney | 0 .00 RPM | 13 .09 RPM |
| SRP017611_liver | 0 .00 RPM | 49 .33 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006686 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000030744 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000029177 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014610 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000003213 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009984 | 3 retrocopies | |
| Felis catus | ENSFCAG00000026471 | 1 retrocopy |
retro_fcat_207 ,
|
| Homo sapiens | ENSG00000120837 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008866 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000005468 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000022570 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000012064 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006543 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000004415 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000008117 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000004892 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000005279 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005731 | 1 retrocopy |