RetrogeneDB ID: | retro_fcat_121 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B2:70755537..70755756(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSFCAG00000029338 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSFCAG00000023254 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.87 % |
| Parental protein coverage: | 98.57 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSEKKQPVDLGLLEEDDEFEEFPAEDWAGL--DEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKME |
| .SEKKQ.V.LGLLEED.EF.E.PAE.WAGL..DED.DAHV.EDNWDDD.VEDDFSNQL..EL.KHGYKME | |
| Retrocopy | VSEKKQLVGLGLLEEDEEFKEIPAEEWAGLGEDEDPDAHVSEDNWDDDSVEDDFSNQLQPELDKHGYKME |
| Parental | T |
| T | |
| Retrocopy | T |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 16 .99 RPM |
| SRP017611_kidney | 0 .10 RPM | 37 .20 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .88 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010434 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000002179 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000010402 | 1 retrocopy | |
| Equus caballus | ENSECAG00000018179 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000002237 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000019778 | 1 retrocopy | |
| Felis catus | ENSFCAG00000023254 | 2 retrocopies |
retro_fcat_1138, retro_fcat_121 ,
|
| Myotis lucifugus | ENSMLUG00000014208 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000026246 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000015337 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011501 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000016474 | 3 retrocopies |