RetrogeneDB ID: | retro_eeur_586 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_349454:10067..10277(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SHFM1 | ||
| Ensembl ID: | ENSEEUG00000002237 | ||
| Aliases: | None | ||
| Description: | split hand/foot malformation (ectrodactyly) type 1 [Source:HGNC Symbol;Acc:10845] |
| Percent Identity: | 84.72 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MSEKKQPVDLGLLEED-DEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDD-FSNQLRAELEKHGYKME |
| MSE.KQ.VDLGLLEED..EFEEFPAED.AGLDEDEDAHVW.DNWDDD.VE.D.FS.QLRAELEKHGYK.E | |
| Retrocopy | MSEEKQLVDLGLLEED<SEFEEFPAED*AGLDEDEDAHVWKDNWDDDSVEVD>FSSQLRAELEKHGYKAE |
| Parental | TS |
| TS | |
| Retrocopy | TS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 44 .96 RPM |
| SRP017611_kidney | 0 .00 RPM | 94 .89 RPM |
| SRP017611_liver | 0 .00 RPM | 57 .40 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010434 | 1 retrocopy | |
| Equus caballus | ENSECAG00000018179 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000002237 | 2 retrocopies |
retro_eeur_290, retro_eeur_586 ,
|
| Felis catus | ENSFCAG00000023254 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000014208 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000026246 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000015337 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011501 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000016474 | 3 retrocopies |