RetrogeneDB ID: | retro_etel_1629 | ||
Retrocopy location | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_284063:3626..3870(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PFDN1 | ||
| Ensembl ID: | ENSETEG00000019281 | ||
| Aliases: | None | ||
| Description: | prefoldin subunit 1 [Source:HGNC Symbol;Acc:8866] |
| Percent Identity: | 67.86 % |
| Parental protein coverage: | 67.21 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | SRTRKHAHLTDTEIMTLVDETHMYEGVGRMFILQSKEVIHNQLLEKQKIAEEKIKELEQKKSYL-ERSVK |
| ....KHAH...TE.MT.VDET.M.EG.GR.F.LQ.K.VIHNQLLEKQK...EKIKELE.KK..L.E.SVK | |
| Retrocopy | AKLKKHAHFAATEAMTMVDETNMSEGTGRTFLLQAKKVIHNQLLEKQK*QREKIKELEHKKFCL<EQSVK |
| Parental | EAEDNIR-EMLMAR |
| E.E.NIR.EMLMAR | |
| Retrocopy | EVEENIR<EMLMAR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000005742 | 8 retrocopies | |
| Equus caballus | ENSECAG00000011843 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005357 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019281 | 1 retrocopy |
retro_etel_1629 ,
|
| Felis catus | ENSFCAG00000001272 | 1 retrocopy | |
| Homo sapiens | ENSG00000113068 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002726 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000000349 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009432 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003376 | 6 retrocopies | |
| Pan troglodytes | ENSPTRG00000017310 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000018653 | 1 retrocopy |