RetrogeneDB ID: | retro_ocun_1885 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | X:43352351..43352597(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSOCUG00000028214 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PFDN1 | ||
| Ensembl ID: | ENSOCUG00000009432 | ||
| Aliases: | None | ||
| Description: | prefoldin subunit 1 [Source:HGNC Symbol;Acc:8866] |
| Percent Identity: | 91.46 % |
| Parental protein coverage: | 67.21 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHNQLLEKQKIAEEKIKELEQKKSYLERSVKEAED |
| K..AHLTDTEIMTLVDETNMYEGVGRM.ILQ.KEVIHNQLLEKQKIAEEKIK.LEQKKSYLERS.KEAED | |
| Retrocopy | KTCAHLTDTEIMTLVDETNMYEGVGRMLILQFKEVIHNQLLEKQKIAEEKIKDLEQKKSYLERSIKEAED |
| Parental | NIREMLMARRAQ |
| NI.EMLMARRAQ | |
| Retrocopy | NIWEMLMARRAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .28 RPM | 32 .95 RPM |
| SRP017611_kidney | 1 .01 RPM | 32 .03 RPM |
| SRP017611_liver | 0 .00 RPM | 7 .71 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000005742 | 8 retrocopies | |
| Equus caballus | ENSECAG00000011843 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019281 | 1 retrocopy | |
| Felis catus | ENSFCAG00000001272 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002726 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000000349 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009432 | 4 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003376 | 6 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018653 | 1 retrocopy |