RetrogeneDB ID: | retro_eeur_58 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | GeneScaffold_3109:7660..7857(+) | ||
| Located in intron of: | ENSEEUG00000010669 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS27A | ||
| Ensembl ID: | ENSEEUG00000002329 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S27a [Source:HGNC Symbol;Acc:10417] |
| Percent Identity: | 67.16 % |
| Parental protein coverage: | 63.73 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | LTGKTITLEVEPSDTIENVKAKIQDK-GIPPDQQRLIFA-GKQLEDGRTLSDYNIQKESTLHLVLRL |
| .TGKTITLE.EPSD...NVK.KI.DK.G..P...RLIF...KQLED..TLSDYNIQKE..LHL.L.L | |
| Retrocopy | VTGKTITLEMEPSDATKNVKVKI*DKEGFSPEHHRLIFM<DKQLEDSCTLSDYNIQKELNLHLLLCL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 59 .46 RPM |
| SRP017611_kidney | 0 .00 RPM | 112 .71 RPM |
| SRP017611_liver | 0 .00 RPM | 82 .64 RPM |