RetrogeneDB ID: | retro_eeur_50 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | GeneScaffold_2711:886609..886828(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RSL24D1 | ||
| Ensembl ID: | ENSEEUG00000006755 | ||
| Aliases: | None | ||
| Description: | ribosomal L24 domain containing 1 [Source:HGNC Symbol;Acc:18479] |
| Percent Identity: | 79.45 % |
| Parental protein coverage: | 53.68 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | DAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQKLQEDMDME |
| DAMKRVEEIKQK.QAKFI.NRL..N.ELQKVQ.IKEVK.NIHLI..PLAGKGKQLEE..VQK.Q.D.DME | |
| Retrocopy | DAMKRVEEIKQKCQAKFIINRLN*N*ELQKVQYIKEVKRNIHLIQSPLAGKGKQLEEETVQKRQQDVDME |
| Parental | DVS |
| D.S | |
| Retrocopy | DIS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .32 RPM | 15 .63 RPM |
| SRP017611_kidney | 2 .25 RPM | 27 .76 RPM |
| SRP017611_liver | 0 .80 RPM | 13 .51 RPM |