RetrogeneDB ID: | retro_ecab_257 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 11:46958821..46959163(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RHOC | ||
| Ensembl ID: | ENSECAG00000010174 | ||
| Aliases: | None | ||
| Description: | ras homolog family member C [Source:HGNC Symbol;Acc:669] |
| Percent Identity: | 55.46 % |
| Parental protein coverage: | 59.59 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | FSKDQFPEVYVP-TVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSI-DSPDSL |
| .S.....E.Y.P..VFE...AD.EVD.KQ.ELALWD.AGQEDYD.LRPLSYP....I..CFS......SL | |
| Retrocopy | YSRTNTQESYQP<RVFESHLADMEVDRKQLELALWDIAGQEDYDLLRPLSYPHFSLIPICFSV<SCCNSL |
| Parental | ENIP-EKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRR-ELAKMKQEPV |
| .NI...K.TPEV.H...NVPIILV.NKKDL..DE..R...L.K....P. | |
| Retrocopy | *NIA<SKRTPEVQHVYTNVPIILV-NKKDLPYDECKRQ*NLKKSPKWPI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 96 .93 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 25 .14 RPM |
| SRP021940_embryo | 0 .00 RPM | 118 .48 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 197 .30 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 168 .39 RPM |
| SRP021940_testis | 0 .00 RPM | 79 .61 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014299 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000013413 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000013657 | 2 retrocopies | |
| Equus caballus | ENSECAG00000010174 | 3 retrocopies |
retro_ecab_112, retro_ecab_257 , retro_ecab_932,
|
| Ficedula albicollis | ENSFALG00000000736 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000002741 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000004807 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000981 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027678 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000001981 | 1 retrocopy | |
| Taeniopygia guttata | ENSTGUG00000017533 | 1 retrocopy | |
| Tetraodon nigroviridis | ENSTNIG00000015041 | 1 retrocopy | |
| Xenopus tropicalis | ENSXETG00000006898 | 1 retrocopy | |
| Xiphophorus maculatus | ENSXMAG00000008103 | 1 retrocopy |