RetrogeneDB ID: | retro_dord_453 | ||
Retrocopy location | Organism: | Kangaroo rat (Dipodomys ordii) | |
| Coordinates: | scaffold_19664:8424..8618(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H2-Ke2 | ||
| Ensembl ID: | ENSDORG00000013828 | ||
| Aliases: | None | ||
| Description: | H2-K region expressed gene 2 [Source:MGI Symbol;Acc:MGI:95908] |
| Percent Identity: | 90.91 % |
| Parental protein coverage: | 50.39 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | ELIQKKLQGEVEKYQQLQKDLSKSMSGRQ-KLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQ |
| ELIQKKLQGEVEKYQQLQK.LSKSMSGRQ..LEAQLTENNIVKEELALLDGSNVVF.LLGPVLV.. | |
| Retrocopy | ELIQKKLQGEVEKYQQLQKGLSKSMSGRQ<ELEAQLTENNIVKEELALLDGSNVVFRLLGPVLVNR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001576 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000010723 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000000956 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000019520 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000013828 | 1 retrocopy |
retro_dord_453 ,
|
| Felis catus | ENSFCAG00000028199 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016778 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000000922 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002364 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024309 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000010559 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028341 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000000983 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000001910 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000473 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000006330 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013280 | 1 retrocopy |