RetrogeneDB ID: | retro_sara_338 | ||
Retrocopy location | Organism: | Shrew (Sorex araneus) | |
| Coordinates: | scaffold_170509:1458..1694(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PFDN6 | ||
| Ensembl ID: | ENSSARG00000006330 | ||
| Aliases: | None | ||
| Description: | prefoldin subunit 6 [Source:HGNC Symbol;Acc:4926] |
| Percent Identity: | 71.08 % |
| Parental protein coverage: | 95.35 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG |
| M.ELI.KK..GEVEKYQQ....LSK.MSGRQKLE..L.EN...KE.LAL.DGS.VVFKLLGP.LVKQEL. | |
| Retrocopy | MTELI*KKQ*GEVEKYQQ---NLSKFMSGRQKLESHLIENDTMKEKLALQDGSDVVFKLLGPILVKQELR |
| Parental | EARATVGK-RLDY |
| E..AT.GK.RLDY | |
| Retrocopy | EVQATLGK<RLDY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001576 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000010723 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000019520 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000013828 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016778 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000000922 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024309 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000010559 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028341 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000000983 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000473 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000006330 | 2 retrocopies |
retro_sara_338 , retro_sara_453,
|
| Tupaia belangeri | ENSTBEG00000013280 | 1 retrocopy |