RetrogeneDB ID: | retro_mmus_1930 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 2:68831016..68831256(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000082836 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | H2-Ke2 | ||
| Ensembl ID: | ENSMUSG00000024309 | ||
| Aliases: | H2-Ke2, H-2Ke2, Ke-2, Pfdn6 | ||
| Description: | H2-K region expressed gene 2 [Source:MGI Symbol;Acc:MGI:95908] |
| Percent Identity: | 95.0 % |
| Parental protein coverage: | 62.99 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG |
| MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQL.ENNI.KEELALLDGS.VVFKLLGPVLVK.ELG | |
| Retrocopy | MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLRENNILKEELALLDGSKVVFKLLGPVLVKEELG |
| Parental | EARATVGKRL |
| EARATVGKRL | |
| Retrocopy | EARATVGKRL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 21 .26 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 29 .57 RPM |
| SRP007412_heart | 0 .00 RPM | 28 .70 RPM |
| SRP007412_kidney | 0 .02 RPM | 25 .04 RPM |
| SRP007412_liver | 0 .05 RPM | 20 .29 RPM |
| SRP007412_testis | 0 .00 RPM | 44 .92 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_88299 | 461 libraries | 351 libraries | 249 libraries | 10 libraries | 1 library |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001576 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000010723 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000019520 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000013828 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016778 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000000922 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024309 | 1 retrocopy |
retro_mmus_1930 ,
|
| Oryctolagus cuniculus | ENSOCUG00000010559 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028341 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000000983 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000000473 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000006330 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000013280 | 1 retrocopy |