RetrogeneDB ID: | retro_cjac_856 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 11:54901553..54901772(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C1D | ||
| Ensembl ID: | ENSCJAG00000006589 | ||
| Aliases: | None | ||
| Description: | C1D nuclear receptor corepressor [Source:HGNC Symbol;Acc:29911] |
| Percent Identity: | 74.67 % |
| Parental protein coverage: | 53.19 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEH |
| VEIHE....FEN.IGAVD.MLKTMMS...NELLQKLD.LEQ.KVDLVS.YTLN..F.VYL.T.G.NPKEH | |
| Retrocopy | VEIHEFF--FENYIGAVDDMLKTMMSAF*NELLQKLDSLEQVKVDLVSVYTLNLKFCVYLSTKGINPKEH |
| Parental | PVKQE |
| .VKQE | |
| Retrocopy | LVKQE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .02 RPM | 5 .46 RPM |
| SRP051959_heart | 0 .00 RPM | 6 .38 RPM |
| SRP051959_kidney | 0 .00 RPM | 14 .84 RPM |
| SRP051959_liver | 0 .00 RPM | 10 .09 RPM |
| SRP051959_lung | 0 .02 RPM | 7 .50 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 6 .14 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 11 .73 RPM |
| SRP051959_spleen | 0 .02 RPM | 8 .82 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_904 |
| Pan troglodytes | retro_ptro_624 |
| Gorilla gorilla | retro_ggor_731 |
| Macaca mulatta | retro_mmul_1109 |