RetrogeneDB ID: | retro_cjac_3293 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 9:37624721..37624957(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CCDC167 | ||
| Ensembl ID: | ENSCJAG00000005622 | ||
| Aliases: | None | ||
| Description: | coiled-coil domain containing 167 [Source:HGNC Symbol;Acc:21239] |
| Percent Identity: | 90.12 % |
| Parental protein coverage: | 82.47 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MTKKKRENLGVALEIDGLEKKLSQCRRDLEAVNSRLHSRELSAEARRSLEKEKNSLMSKASNYEKELKLL |
| MTKKK.ENLGVALEIDGLEKKLSQCRRDLEAVNSR.HSRELS.EARRSLEKEKNSLMS...NYEKELKLL | |
| Retrocopy | MTKKKWENLGVALEIDGLEKKLSQCRRDLEAVNSRFHSRELSPEARRSLEKEKNSLMSEVFNYEKELKLL |
| Parental | -RQENWKNMLL |
| .RQ.NWKNMLL | |
| Retrocopy | <RQ-NWKNMLL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 1 .15 RPM |
| SRP051959_heart | 0 .00 RPM | 0 .60 RPM |
| SRP051959_kidney | 0 .00 RPM | 0 .51 RPM |
| SRP051959_liver | 0 .00 RPM | 0 .67 RPM |
| SRP051959_lung | 0 .00 RPM | 0 .63 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 1 .12 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 0 .31 RPM |
| SRP051959_spleen | 0 .00 RPM | 1 .18 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012069 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000030835 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005622 | 2 retrocopies |
retro_cjac_3293 , retro_cjac_960,
|
| Felis catus | ENSFCAG00000006745 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024018 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000921 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016563 | 1 retrocopy |