RetrogeneDB ID: | retro_btau_30 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 17:15274688..15274943(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSBTAG00000045665 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CCDC167 | ||
| Ensembl ID: | ENSBTAG00000012069 | ||
| Aliases: | CCDC167, C23H6orf129, C6orf129 | ||
| Description: | Coiled-coil domain-containing protein 167 [Source:UniProtKB/Swiss-Prot;Acc:A1A4P9] |
Retrocopy-Parental alignment summary:
>retro_btau_30
ATGATCGATGGGCTGGAGAAGAAGCTGTCACAATGTCGGAGAGACCTGGAAGTCGTGAACTCCAGGCTCTGTGGGGTGGA
GCTGAGCTCAGAGGCCAGGAGGTCTCTGGAGAAGGAGAAAAGCAGCCTGATGAACAAAGCCTCCAACTATGAGAAGGAGC
TGAAGTTGCTTCGGCAGGAGAACCGCAAGAACATGCTGCTGTCTGTGGCCATCTTCCTCCTGCTGACTGTCATCTATGCC
TACTGGGCCCTGTGA
ORF - retro_btau_30 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 85.57 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | IDGLEKKLSQCRRDLEVVNSRLCGVELSSEARRSLEKEKSSLMNKASNYEKELKLLRQENRKNMLLSVAI |
| IDGLEKKLSQCRRDLEVVNSRLCGVELSSEARRSLEKEKSSLMNKASNYEKELKLLRQENRKNMLLSVAI | |
| Retrocopy | IDGLEKKLSQCRRDLEVVNSRLCGVELSSEARRSLEKEKSSLMNKASNYEKELKLLRQENRKNMLLSVAI |
| Parental | FLLLTVIYAYWAL |
| FLLLTVIYAYWAL | |
| Retrocopy | FLLLTVIYAYWAL |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 12 .54 RPM |
| ERP005899_muscle | 0 .11 RPM | 18 .42 RPM |
| SRP017611_brain | 0 .00 RPM | 5 .76 RPM |
| SRP017611_kidney | 0 .00 RPM | 7 .59 RPM |
| SRP017611_liver | 0 .15 RPM | 27 .11 RPM |
| SRP030211_testis | 0 .13 RPM | 41 .22 RPM |
Bos taurus was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_btau_30 retrocopy.
Bos taurus was not studied using FANTOM5 data.
retro_btau_30 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_btau_30 has 0 orthologous retrocopies within eutheria group .Parental genes homology:
Parental genes homology involve 7 parental genes, and 9 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012069 | 2 retrocopies |
retro_btau_30 , retro_btau_517,
|
| Canis familiaris | ENSCAFG00000030835 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005622 | 2 retrocopies | |
| Felis catus | ENSFCAG00000006745 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024018 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000000921 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016563 | 1 retrocopy |