RetrogeneDB ID: | retro_mmus_3487 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | X:93931601..93931834(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000081573 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ccdc167 | ||
| Ensembl ID: | ENSMUSG00000024018 | ||
| Aliases: | Ccdc167, 1110021J02Rik | ||
| Description: | coiled-coil domain containing 167 [Source:MGI Symbol;Acc:MGI:1915847] |
| Percent Identity: | 79.75 % |
| Parental protein coverage: | 80.41 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | EKLSRCRKDLEAVTSQLYRAEL-SPEDRRSLEKEKHTLMNKASKYEKELKLLRHENRKNTLLSVAIFTVF |
| EKLS.CRKDLEA.TSQLYRA...SPEDRRSLEKEK.TL.NKASKYEKELKLL..ENR.N.LLSVAIF.VF | |
| Retrocopy | EKLSQCRKDLEAMTSQLYRADR<SPEDRRSLEKEKNTLRNKASKYEKELKLL*QENRQNMLLSVAIFIVF |
| Parental | ALLYAYWTM |
| ..L.A.WTM | |
| Retrocopy | TVLHAPWTM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 7 .36 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 17 .28 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .26 RPM |
| SRP007412_kidney | 0 .00 RPM | 4 .60 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .03 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .97 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012069 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000030835 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000005622 | 2 retrocopies | |
| Felis catus | ENSFCAG00000006745 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024018 | 1 retrocopy |
retro_mmus_3487 ,
|
| Otolemur garnettii | ENSOGAG00000000921 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016563 | 1 retrocopy |