RetrogeneDB ID: | retro_cjac_2541 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 5:84303126..84303450(+) | ||
| Located in intron of: | ENSCJAG00000001554 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCJAG00000001174 | ||
| Aliases: | None | ||
| Description: | Cytochrome c oxidase subunit 6A, mitochondrial [Source:UniProtKB/TrEMBL;Acc:F7I4Z3] |
| Percent Identity: | 85.19 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | MAAAVASRLSRLLGRSRPQVGRPMSSAAHSGEGSARMWKILTFFVALPGVGVSMLNVYLKSQKEHERPEF |
| MAAAVASRLS.LLG.SRP..G.PMSSAAHSGEGSA.M.K..TFFV.LPGVGVSMLNVYL..QKEHE.PEF | |
| Retrocopy | MAAAVASRLSWLLGWSRP*LGLPMSSAAHSGEGSALM*KVFTFFVTLPGVGVSMLNVYLTLQKEHETPEF |
| Parental | VAYPHLRIRTKPFPWGDGNHTLFHNSHVNPLPTGYEDE |
| V.YPHL.IRTKPFPWGDGN.TLFHNSHVNPLPTGYEDE | |
| Retrocopy | VTYPHLCIRTKPFPWGDGNQTLFHNSHVNPLPTGYEDE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .31 RPM | 34 .39 RPM |
| SRP051959_heart | 0 .37 RPM | 14 .28 RPM |
| SRP051959_kidney | 0 .80 RPM | 54 .80 RPM |
| SRP051959_liver | 0 .35 RPM | 59 .59 RPM |
| SRP051959_lung | 0 .73 RPM | 23 .51 RPM |
| SRP051959_lymph_node | 0 .73 RPM | 20 .96 RPM |
| SRP051959_skeletal_muscle | 0 .28 RPM | 6 .33 RPM |
| SRP051959_spleen | 0 .84 RPM | 28 .28 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012788 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000031458 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000009222 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001174 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000006426 | 1 retrocopy | |
| Equus caballus | ENSECAG00000012512 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000016826 | 1 retrocopy | |
| Felis catus | ENSFCAG00000031188 | 9 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010330 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000009873 | 6 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003561 | 18 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002226 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000001170 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008018 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000011541 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000142 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000010359 | 1 retrocopy |