RetrogeneDB ID:

retro_chof_746

Retrocopy
location
Organism:Sloth (Choloepus hoffmanni)
Coordinates:scaffold_142618:3934..4540(-)
Located in intron of:None
Retrocopy
information
Ensembl ID:None
Aliases:None
Status:NOVEL
Parental gene
information
Parental gene summary:
Parental gene symbol:MRPL15
Ensembl ID:ENSCHOG00000005299
Aliases:None
Description:mitochondrial ribosomal protein L15 [Source:HGNC Symbol;Acc:14054]


Retrocopy-Parental alignment summary:






>retro_chof_746
AGCTTCAGATGCCAGTACCAGCTGTTGAGTCTCAATAGACTGCAGGGTCTTATTGAATAGGGTCAAGATGATCCTACGCA
ACCTGTTGACTTAACCCAGCTTGTCAATGGCAGAGGTGTGACCATCCAGCCACTTAAGTGGGATTATGGTGCCCAGCTTG
TAGAGGAGGGGCTGACACCTTTAAGGCAAAAGCTAATATTGAAGTACAGTTGGCTTCATAAGCAGCAATTGCTGCAATTG
AAAAAAAATGCTGGTGTTGTTACAATAGCCTTCCATGACCCAAGGAGTCTGGAAATTCTGTATGAGCCAGTTCCATTCTT
TTTGCATGGATTACCCAATCCAAAACATATGCTTCCACCTGAATCCCTGGTGCCTTGTTATAACCATGCAAAGAACCATG
GCTATCTGGCAGATCCTGGCAAATTTCCTGAAGCAAAACTTGAACTCGCCAAGAAGTACGGTTATATCTTACCTGATAGC
ACCAAAGTTGAGCTCTTCGGGATGCTAAGCACTCGAAAGGACCCAAGGCAGGTTTTCTTTGGTCTTGCTCCAGGATGGGT
AGTGAATATGGCTGAAAAGAAAATCTTAAAACCTACAGATGAGCAT

ORF - retro_chof_746 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity: 81.37 %
Parental protein coverage: 69.69 %
Number of stop codons detected: 2
Number of frameshifts detected 2


Retrocopy - Parental Gene Alignment:

ParentalSFRRQYQL-SLNRLQYLIL-GRVDPTQPIDLTQLVNGRGVTIQPLKRDYGVQLVEE-GADTFKAKVNIEV
SFR.QYQL.SLNRLQ.LI..G..DPTQP.DLTQLVNGRGVTIQPLK.DYG.QLVEE.GADTFKAK.NIEV
RetrocopySFRCQYQLLSLNRLQGLIE*GQDDPTQPVDLTQLVNGRGVTIQPLKWDYGAQLVEE<GADTFKAKANIEV
ParentalQLASELAIAAI-EKNGGVVTTAFYDPRSLEILCKPVPFFLRGQPIPKRMLPPESLVPYYTDAKNRGYLAD
QLAS..AIAAI.....GVVT.AF.DPRSLEIL..PVPFFL.G.P.PK.MLPPESLVP.Y..AKN.GYLAD
RetrocopyQLAS*AAIAAI>XXXAGVVTIAFHDPRSLEILYEPVPFFLHGLPNPKHMLPPESLVPCYNHAKNHGYLAD
ParentalPGKFPEARLELARKYGYILPDITKDELFRMLSTRKDPRQIFFGLAPGWVVNMADKKILKPTDEH
PGKFPEA.LELA.KYGYILPD.TK.ELF.MLSTRKDPRQ.FFGLAPGWVVNMA.KKILKPTDEH
RetrocopyPGKFPEAKLELAKKYGYILPDSTKVELFGMLSTRKDPRQVFFGLAPGWVVNMAEKKILKPTDEH

Legend:
*Stop codon
>Forward frameshift by one nucleotide
<Reverse frameshift by one nucleotide






Choloepus hoffmanni was not studied using RNA-Seq expression data.
Choloepus hoffmanni was not studied using ChIP-Seq data.
Choloepus hoffmanni was not studied using EST data.
Choloepus hoffmanni was not studied using FANTOM5 data.
retro_chof_746 was not experimentally validated.

Retrocopy orthology:
Choloepus hoffmanni does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.

Parental genes homology:
Parental genes homology involve 16 parental genes, and 24 retrocopies.

Species Parental gene accession Retrocopies number
Bos taurus ENSBTAG000000011741 retrocopy
Canis familiaris ENSCAFG000000069882 retrocopies
Choloepus hoffmanni ENSCHOG00000005299 3 retrocopies
retro_chof_1379, retro_chof_1719, retro_chof_746 ,
Callithrix jacchus ENSCJAG000000167191 retrocopy
Dasypus novemcinctus ENSDNOG000000176641 retrocopy
Erinaceus europaeus ENSEEUG000000014542 retrocopies
Echinops telfairi ENSETEG000000017241 retrocopy
Mustela putorius furoENSMPUG000000105331 retrocopy
Mus musculus ENSMUSG000000338452 retrocopies
Ornithorhynchus anatinus ENSOANG000000072861 retrocopy
Otolemur garnettii ENSOGAG000000037681 retrocopy
Ochotona princeps ENSOPRG000000009212 retrocopies
Rattus norvegicus ENSRNOG000000085662 retrocopies
Sus scrofa ENSSSCG000000305781 retrocopy
Tarsius syrichta ENSTSYG000000141061 retrocopy
Tursiops truncatus ENSTTRG000000118442 retrocopies



Copyright © RetrogeneDB 2014-2017