RetrogeneDB ID: | retro_cfam_761 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 17:36794315..36794747(+) | ||
| Located in intron of: | ENSCAFG00000007174 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPL11 | ||
| Ensembl ID: | ENSCAFG00000012706 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L11 [Source:HGNC Symbol;Acc:14042] |
| Percent Identity: | 78.38 % |
| Parental protein coverage: | 75.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | MSKLNRAARALRKPEAGGVIRTIVRAGQAMTGPPLGPILGQRGVSINQFC-KEFNEKTKDIK-EGIPLPT |
| MS.LNRA..ALRKPEA.G.IRTI.RAGQA..GPPLGPILGQRGVSINQFC........K..K.EGIPLPT | |
| Retrocopy | MSMLNRATQALRKPEARGMIRTIMRAGQATSGPPLGPILGQRGVSINQFCARSSTRRQKTSK<EGIPLPT |
| Parental | -KIFVKPDRTFEIK-IGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIAQVKAQDEAFALQDVP |
| .KIFVKP.RTFEIK.IGQPTVSYFLKAAAGIEKGA.QTGKEVA.LVTLKHVYEIAQ.KAQDEAFALQDV. | |
| Retrocopy | <KIFVKPNRTFEIK<IGQPTVSYFLKAAAGIEKGAWQTGKEVASLVTLKHVYEIAQIKAQDEAFALQDVV |
| Parental | LSSVVRSI |
| .S....S. | |
| Retrocopy | HSVLCGSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 19 .91 RPM |
| SRP017611_brain | 0 .08 RPM | 18 .66 RPM |
| SRP017611_kidney | 0 .00 RPM | 41 .54 RPM |
| SRP017611_liver | 0 .22 RPM | 10 .66 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000012706 | 1 retrocopy |
retro_cfam_761 ,
|
| Callithrix jacchus | ENSCJAG00000001470 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004111 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015216 | 2 retrocopies | |
| Homo sapiens | ENSG00000174547 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001300 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000004047 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024902 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000006111 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000010448 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000003025 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003924 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000025971 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008712 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000002678 | 1 retrocopy |