RetrogeneDB ID: | retro_cfam_1967 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 8:62425722..62425965(-) | ||
| Located in intron of: | ENSCAFG00000017591 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PAM16 | ||
| Ensembl ID: | ENSCAFG00000019226 | ||
| Aliases: | PAM16, MAGMAS, TIMM16 | ||
| Description: | Canis lupus familiaris presequence translocase-associated motor 16 homolog (S. cerevisiae) (PAM16), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001003391] |
| Percent Identity: | 63.22 % |
| Parental protein coverage: | 69.6 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | GRAGHQSAAASNLSGLSLQEAQQILNVSKLSPEEIQKNYEHLFKVNDKSVGGSFYLQSKVVRAWERLQEE |
| G.A.HQS.A.SNLS.LSLQEAQQ...VSKLSP.EIQKNYEHLFK.ND.SVGGS.YL.SKV..A.E..... | |
| Retrocopy | GWA*HQSVATSNLSSLSLQEAQQSPQVSKLSPKEIQKNYEHLFKANDVSVGGS-YLWSKVA*AEEL---R |
| Parental | LRIQAQEDREKEQMPKT |
| ...Q.....E..QMP.T | |
| Retrocopy | IQAQEDREKE--QMPNT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .13 RPM | 27 .72 RPM |
| SRP017611_brain | 0 .16 RPM | 10 .32 RPM |
| SRP017611_kidney | 0 .07 RPM | 32 .56 RPM |
| SRP017611_liver | 0 .07 RPM | 9 .43 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009200 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019226 | 1 retrocopy |
retro_cfam_1967 ,
|
| Callithrix jacchus | ENSCJAG00000019772 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000010921 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000014888 | 1 retrocopy | |
| Equus caballus | ENSECAG00000019387 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000007432 | 7 retrocopies | |
| Echinops telfairi | ENSETEG00000006416 | 1 retrocopy | |
| Felis catus | ENSFCAG00000027971 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000008921 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000014301 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004608 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007947 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000003461 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001347 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000009306 | 1 retrocopy |