RetrogeneDB ID: | retro_xtro_18 | ||
Retrocopylocation | Organism: | Xenopus (Xenopus tropicalis) | |
| Coordinates: | GL172711.1:405918..406164(+) | ||
| Located in intron of: | ENSXETG00000027230 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | gtf2a2 | ||
| Ensembl ID: | ENSXETG00000022002 | ||
| Aliases: | None | ||
| Description: | general transcription factor IIA, 2, 12kDa [Source:RefSeq peptide;Acc:NP_001005107] |
| Percent Identity: | 74.39 % |
| Parental protein coverage: | 75.23 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MAYQLYRNTTLGNSLQESLDELIQSQQINPQLALQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRFCDN |
| MAYQ.YR.TTLGNSLQESLDELIQ.QQIN.Q.AL..LL.F.KAINSAL...VR.RVNFRG.L..YRFCDN | |
| Retrocopy | MAYQPYRITTLGNSLQESLDELIQFQQINSQFALKFLLKFNKAINSALP*WVRRRVNFRGFLKNYRFCDN |
| Parental | VWTFVLNDVEFR |
| .WTFV...VE.R | |
| Retrocopy | IWTFVFKKVELR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .13 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .13 RPM |
| SRP007412_liver | 0 .09 RPM | 0 .00 RPM |
| SRP007412_skeletal_muscle | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000010298 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016665 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000000816 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000007867 | 3 retrocopies | |
| Homo sapiens | ENSG00000140307 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018428 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011636 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007061 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012841 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007129 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011062 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000012228 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004583 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000004010 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000001053 | 9 retrocopies | |
| Xenopus tropicalis | ENSXETG00000022002 | 1 retrocopy |
retro_xtro_18 ,
|