RetrogeneDB ID: | retro_sscr_545 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 16:34943549..34943866(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | GTF2A2 | ||
| Ensembl ID: | ENSSSCG00000004583 | ||
| Aliases: | None | ||
| Description: | general transcription factor IIA, 2, 12kDa [Source:HGNC Symbol;Acc:4647] |
| Percent Identity: | 77.98 % |
| Parental protein coverage: | 99.08 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRFCDNV |
| .YQLYR.TT.G.SLQESLDEL.QSQ.ITPQ.AL.VLL.FDKAINSALAQRVRNRVNFRG.LN.YRFC.NV | |
| Retrocopy | SYQLYRTTTVGKSLQESLDELTQSQEITPQPAL*VLLPFDKAINSALAQRVRNRVNFRGFLNMYRFCNNV |
| Parental | WTFVLNDVEFREVTELIKVDKVKI-VACDGKNTGSNTTE |
| WTF.LNDVEFREVT...K..K.K..VAC..KNT.SNTTE | |
| Retrocopy | WTFILNDVEFREVT--LKWTK*KL<VACNAKNTSSNTTE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 3 .19 RPM |
| SRP014902_testis | 0 .14 RPM | 9 .76 RPM |
| SRP018288_heart | 0 .03 RPM | 26 .27 RPM |
| SRP018288_kidney | 0 .10 RPM | 24 .13 RPM |
| SRP018288_liver | 0 .00 RPM | 13 .27 RPM |
| SRP018288_lung | 0 .00 RPM | 11 .61 RPM |
| SRP018856_adipose | 0 .00 RPM | 3 .19 RPM |
| SRP035408_brain | 0 .00 RPM | 22 .68 RPM |
| SRP035408_liver | 0 .00 RPM | 19 .67 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000010298 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016665 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000000816 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000007867 | 3 retrocopies | |
| Homo sapiens | ENSG00000140307 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018428 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011636 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007061 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012841 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007129 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011062 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000012228 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004583 | 3 retrocopies |
retro_sscr_545 , retro_sscr_934, retro_sscr_935,
|
| Ictidomys tridecemlineatus | ENSSTOG00000004010 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000001053 | 9 retrocopies | |
| Xenopus tropicalis | ENSXETG00000022002 | 1 retrocopy |