RetrogeneDB ID: | retro_ttru_454 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
| Coordinates: | GeneScaffold_2343:357337..357577(+) | ||
| Located in intron of: | ENSTTRG00000017338 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | TMEM254 | ||
| Ensembl ID: | ENSTTRG00000006122 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 254 [Source:HGNC Symbol;Acc:25804] |
| Percent Identity: | 87.5 % |
| Parental protein coverage: | 56.34 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | WVVFWPEAIPYQSLGPLGPFTQYLLEHHHTLLHSWYWLAWLIHVGESLYAIVLCKSKGITNSWTQLLWFL |
| W..F.PE.IPYQSLGPLGPFTQYLLEHHHTL.HSWYWLAWLIHVGESLYAI.L.KSKGIT.SW.QLLWFL | |
| Retrocopy | WMIF*PETIPYQSLGPLGPFTQYLLEHHHTLVHSWYWLAWLIHVGESLYAIGLFKSKGITHSWIQLLWFL |
| Parental | QTFLFGMASL |
| QTFLFGMAS. | |
| Retrocopy | QTFLFGMASI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000015748 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000007670 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000024625 | 1 retrocopy | |
| Felis catus | ENSFCAG00000026147 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007585 | 16 retrocopies | |
| Macaca mulatta | ENSMMUG00000003015 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000072676 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013679 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000028898 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006920 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000006122 | 1 retrocopy |
retro_ttru_454 ,
|