RetrogeneDB ID: | retro_sscr_888 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 6:127059288..127059550(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PRDX5 | ||
| Ensembl ID: | ENSSSCG00000013030 | ||
| Aliases: | None | ||
| Description: | peroxiredoxin 5 [Source:HGNC Symbol;Acc:9355] |
| Percent Identity: | 53.93 % |
| Parental protein coverage: | 54.32 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | CLSVNDVFVTEMWGRAHNTEGKVRLLADPTGAFGKE-TDLLLDDSLVSLFGNRRLKRFSMVIEDGIVKSL |
| CL..N..FV......A.N.E....L.AD..G..G...TDLLLD.SL..LFG....KRFSMVI.D.IVK.L | |
| Retrocopy | CLRAN-FFVNGK*E*ANNIEDDIELRADSMGVLGDR>TDLLLDNSLLALFGDK*HKRFSMVINDSIVKAL |
| Parental | NVEPDGTGLTCSLAPNIIS |
| N.EP..TGLT.SLAP...S | |
| Retrocopy | NMEPRSTGLTNSLAPSTLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 12 .61 RPM |
| SRP014902_testis | 0 .00 RPM | 43 .71 RPM |
| SRP018288_heart | 0 .00 RPM | 7 .28 RPM |
| SRP018288_kidney | 0 .00 RPM | 142 .83 RPM |
| SRP018288_liver | 0 .00 RPM | 116 .73 RPM |
| SRP018288_lung | 0 .00 RPM | 115 .98 RPM |
| SRP018856_adipose | 0 .00 RPM | 94 .93 RPM |
| SRP035408_brain | 0 .00 RPM | 108 .91 RPM |
| SRP035408_liver | 0 .00 RPM | 333 .63 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017959 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000008648 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018014 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000004647 | 1 retrocopy | |
| Equus caballus | ENSECAG00000017747 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000000264 | 3 retrocopies | |
| Felis catus | ENSFCAG00000028856 | 3 retrocopies | |
| Homo sapiens | ENSG00000126432 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001337 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000025661 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000013397 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000012907 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005003 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000010811 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000003106 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003835 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000013030 | 2 retrocopies |
retro_sscr_1041, retro_sscr_888 ,
|